DPCstruct | MC6586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 203 ± 21 aa |
| Standard deviation of domain lengths | 20.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A427XI50 | 180-353 | AVLRDKLLPTYRSLLAPGASSDPSPPGDGEDPSVGSVFARRTREAAVLDRFIALRIGEDWRKAESELCEDLGLETEIFSGLQPAARM… |
| W4K3K6 | 1-210 | MHILRSTYLPAYTSLLRAPYTSDPFPLSSPPPTTTTTTTTTTTTPPTSTITSTPTPDLPLLPSPHRETAILDAFIALKVREDVWADA… |
| A0A316UG82 | 97-322 | None |
| M5FPP0 | 126-310 | None |
| A0A2G8RXD9 | 15-244 | None |
| K5X0J0 | 243-473 | None |
| A0A0C3B5A5 | 191-404 | None |
| A0A316UME5 | 1-175 | None |
| L8X5R3 | 390-587 | None |
| K5WR82 | 1-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.