DPCstruct | MC6585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 280 ± 42 aa |
| Standard deviation of domain lengths | 41.72 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4K0S3 | 19-315 | ARLWQLADNTQDAREKLSIQMKANKYMLTGIHVDENYQASIEPLRNAVTVDEQFTITRDYDSLIGFADDIPLRNGSLLVFTVLSKDL… |
| A0A4Y7R4B3 | 54-309 | EKDIPFTKIVKDTLELIETDLDFEMLRLSLCGVTDEAALKIVHDHLSKSPFCRVRRFYGNIVGISPRIMASGSLTLDTTPSWEHSLP… |
| W9NBR7 | 111-412 | None |
| W9NHC0 | 88-376 | None |
| W9NI69 | 652-895 | None |
| A0A0F7ZGF8 | 2-297 | None |
| A0A1B8A4Q4 | 304-574 | None |
| A0A1B8A5Z8 | 324-685 | None |
| A0A6A4GL36 | 26-308 | None |
| A0A1B8A3L6 | 323-651 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.