DPCstruct | MC6582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 10.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1QZZ6 | 2-89 | NPKMSTEQENMLHNIGVVGFVALEMALYLDTHPTDREAMEYFNHYMRLKNQMTQEYANKFGPLTLSVADNSSKEWKWALQPMPWEGGC |
| A0A1C5Y3N2 | 3-84 | SRAMLLKRLQVCDFVLTEVGLFLDTHPNDKEALAYYHKYLALKQETQTEFTRRFGTVSRYEPKNSDTWDWVDNPWPWDNSEG |
| R6BCA4 | 84-164 | None |
| A0A1W6WF67 | 2-79 | None |
| A0A1C5RSG4 | 9-95 | None |
| R6GVZ5 | 43-130 | None |
| R7INL1 | 50-140 | None |
| A0A0J1GEK5 | 135-234 | None |
| R5FYF3 | 10-124 | None |
| A0A3D1HZA2 | 108-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.