DPCstruct | MC6581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 166 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E3DLS8 | 1-146 | MKKTRLKKLGHLYATDEMLCMAEQDIPENKKIGWQRVEPVFQRKVYLQSQICDGILVVAIYLARDLRLGSIKPLYENFIDKSKREYL… |
| A0A1C5X460 | 1-175 | MRRGELLKLPELKVTETMRKTVRKDQGHQVLRCGRAPIWSATYYWFYRAKKTGTVLEIDVFTRDMILDGTAHPKYRVFLLEENKYYT… |
| A0A1M7YNB9 | 3-168 | None |
| A0A413KZ43 | 1-154 | None |
| A0A1Y4RSJ9 | 1-174 | None |
| A0A1Q6KP44 | 1-174 | None |
| A0A3E4VB96 | 1-163 | None |
| A0A3E4UUS0 | 1-184 | None |
| A0A3A6FJM2 | 108-271 | None |
| A0A1M7BLS9 | 2-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.