DPCstruct | MC6580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.93 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316MHS1 | 7-118 | MDISGLGTYSSIPLGLDFSFNGGDYRGRKGSAGISLDLGKSTDSTGLRLSDEDKRLIRELQKRDQEVRAHERAHKTAAGSLARGSAT… |
| A0A848G4S8 | 2-89 | AISSVSSASSASAWSAASRASGSGLSAEEQRIVDKLAQRDKEVRAHEQAHLSAAGGLATSGASYTYETGPDGRRYAVGGEVGIDVSPG |
| A0A2G6D085 | 126-245 | None |
| A0A1G3FDB5 | 32-139 | None |
| A0A806KHK2 | 29-141 | None |
| A0A7H9CHC1 | 26-143 | None |
| A0A496UHG9 | 41-146 | None |
| A0A2A4W5W4 | 46-167 | None |
| A0A7C3CGE8 | 1-102 | None |
| A0A1A8XUD3 | 16-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.