DPCstruct | MC658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 11.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2H5E5 | 4-111 | VAITPFFVPDGYVVAEETPTAAQLEYGNDAGDALVGKHLMFHWEGVGWCEGVIEERNTDAKEKIGKDKVNFWVHYHIDDNTSKHNLE… |
| A0A7S0Q864 | 2-138 | EEGGEEEGGEEDMSEGEEDDDTAEALEDAVGSIENPPTGYEFVDEVPVLDTEEDLKKLIGREVMHAWATEDIFGWFQGRITHYGCSQ… |
| R1ESE5 | 51-166 | None |
| R1ECL4 | 670-810 | None |
| A0A7S4M3N1 | 17-138 | None |
| A0A7S4HVR0 | 2-128 | None |
| A0A7S4HDZ3 | 1-109 | None |
| R1G2U6 | 201-322 | None |
| A0A7S2JN90 | 329-457 | None |
| A0A6H5KNG7 | 238-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.