DPCstruct | MC6579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 8.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A009K0I0 | 61-148 | MDKQFKQGLKKASAENSPFSALGYILTTGANWAKPIENFKLTIERDKNELVSFCWDGPVKKISPTQFQMIKTKFVPKKDLDIIFVRVK |
| C7RMZ3 | 8-99 | SPGLIHRLERSAPRDAAPLWGGTGSYIPKTANTWRGPIRDFTLRLRKSSLEESISLCFPGQVENVDALTLEAKIADFAPAADLRIRF… |
| Q08ZL9 | 128-213 | None |
| A0A6H3TVP4 | 103-190 | None |
| A0A257XG41 | 28-116 | None |
| A0A0Q8AZV1 | 2-78 | None |
| A0A6N8DMU5 | 118-219 | None |
| A0A258K2C0 | 2-73 | None |
| A0A336N4Z0 | 1-70 | None |
| A0A2D8YRC0 | 105-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.