DPCstruct | MC6578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 9.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16133 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1SXM6 | 2-112 | QAPASAVQQLQAFKALPKFEPDEMYTGAWPAEVRPVLNSVLNQSADEFLAIATSGPTQERYQQALATGLDKIDGDELDTEDRERVAV… |
| A0A2H9VJT7 | 30-149 | VIPRPDQKIHVSQATVAGLTALRGRTKYVELPGTIYNGMRPENARLQAEEQINRLLDRLLGGLPVNPSKKFVMTQFAETMAQFDAID… |
| A0A699GE81 | 758-867 | None |
| A0A095U1J0 | 16-145 | None |
| A0A2T6DX74 | 6-130 | None |
| A0A1M7R456 | 13-134 | None |
| A0A495U8W8 | 10-116 | None |
| A0A522DBW5 | 166-277 | None |
| A0A2W5E0W8 | 17-130 | None |
| A0A848GS16 | 7-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.