DPCstruct | MC6573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 293 ± 44 aa |
| Standard deviation of domain lengths | 44.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553UHM6 | 73-338 | AERTLTKGQARLWVILHRLAVDVGRERGYTATPHHVAYHCPALTIAGALGYTDRHIRTLAAGLERAGLLDCGGHAQQIGARSLYDGT… |
| A0A1U7NW53 | 1-267 | MVLHLPNEMMAAQVEKNVSTLRLWTPLLEELGYIDARPHYTTMTTPGGQRIPVIDGTLYAICLQPGHKAKLTYQDLSAQYRNLDEDR… |
| A0A100HNK6 | 84-387 | None |
| A0A4V2ZCW4 | 112-484 | None |
| A0A4R5G726 | 88-375 | None |
| A0A016QLS1 | 1-233 | None |
| A0A7X1NZ36 | 10-261 | None |
| A0A6I4YB44 | 73-424 | None |
| A0A3S0KF19 | 33-357 | None |
| A0A7W8JYL2 | 12-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.