DPCstruct | MC6572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 14.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 30.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4DYM0 | 9-98 | RGDVEQLVRSVLLLENEDDVRAFLTDLCTPREICDFAQRLQVARYLDEGEPYVEVQARTGASSTTVSRVSKALNGAHGGYRRILIKL… |
| C0W9Z1 | 5-96 | LNKRELHRLAHAFILLKNDRMCLDFLEDICTPNELKALSQRLEVAVRLHRGENYAKIVNDTGASSTTVSRVNRCLNYGAGGYRKVIP… |
| A0A3A4Z9G6 | 30-138 | None |
| A0A0G2B3L6 | 1-128 | None |
| A0A5Q4F1S8 | 4-98 | None |
| A0A6A8M6C3 | 19-111 | None |
| A0A1F7V9Z6 | 2-88 | None |
| A0A1F4VLW5 | 2-111 | None |
| A0A1F5EUK3 | 1-94 | None |
| G8TXC5 | 42-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.