DPCstruct | MC6570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 405 ± 21 aa |
| Standard deviation of domain lengths | 21.48 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370E0N6 | 29-409 | HKLAIDGRDRDQLIAFGRRLAAHIRFATPFGNEGNWSPLFELLKNPDSFAEQHDAPPQAALFLAFIKLFEKAQGELNRLSKSHLDYY… |
| A0A257WCB1 | 100-487 | SDQFFHTNSIPAEFDRIDYSTISLKQLFRRAFESYARIISLAGDMLTASLENSSSHYAHHGLLLAFLRLFGLVQEEMNKFTRKHLEY… |
| K5Y350 | 11-432 | None |
| A0A7G3GG62 | 1-438 | None |
| A0A1R3VQL0 | 6-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.