DPCstruct | MC657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 267 ± 21 aa |
| Standard deviation of domain lengths | 20.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3BWY7 | 76-331 | PGPGPTPSACKWPVFASRAELQADAWGQYYKAVYGALPTAGDFPLDVSTNWLLHDGAIIKAGLQTLCKSSECPLNEKDRYSTNDMYQ… |
| A0A7S0Q4M1 | 26-291 | SDEARARYLQLARLPRFVGVVNSTKWACYLQLVYGKPVVLAAWEELDISRFELLYTRKLAQCGLDVHAWQLPGRLPGALGYSLKWDW… |
| A0A7S1F448 | 396-644 | None |
| A0A0G4F3R6 | 37-348 | None |
| A0A7S3F385 | 136-391 | None |
| A0A7S3SRS7 | 107-394 | None |
| A0A2D7CQE4 | 2-227 | None |
| A0A7S0ZTJ4 | 31-316 | None |
| A0A7S3AI47 | 36-325 | None |
| A0A7S0P1H3 | 133-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.