DPCstruct | MC6569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D8T232 | 107-243 | RRLLFIPALLNTYYFDFFDNKFVYYSSSYLSSIIDYPYDRPIPEVIGLNYFNSDEMSANNGYISDGFANAGSIGIFINIVLASILLK… |
| A0A0M5JCX3 | 1-140 | MKNHFLYYDFFSSNEKVYLSNSIFRFFIENPYPIPIPNLIGSIYYQNYDTWVNVGYLADAYMNFGFLGILLFSILLGIILKMFDTLS… |
| A0A855KH28 | 143-288 | None |
| H0UK45 | 649-784 | None |
| A0A533RIX2 | 294-425 | None |
| A0A0M1JDH7 | 41-182 | None |
| W7DBV6 | 187-333 | None |
| C1DTA8 | 1-163 | None |
| A0A109JJF8 | 86-216 | None |
| A0A2E2WNJ6 | 3-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.