DPCstruct | MC6566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 132 ± 6 aa |
| Standard deviation of domain lengths | 6.24 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0469 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7X2V0 | 3-130 | DFDKEVAKIEKYNQPILDGFKIWLQKANLSAKTIKNHILNIEFFAEYLVSYEPLQKLDEADDQDVYDFLMDYFPHKALWASESSTKS… |
| A0A2T1GKF3 | 5-140 | ANYEADSKKIIAANKKLLSEFKIWLQSSNLSEKTINNHISNISFYINEYLLYYEEPIKAQDGIGDVSTFLGDWFIRKAMWASKAHIK… |
| A0A0R2K0V6 | 213-338 | None |
| A0A842RMS0 | 4-131 | None |
| A0A430AQF3 | 41-169 | None |
| A0A3C1DFN8 | 46-176 | None |
| A0A3A4NHY7 | 27-153 | None |
| A0A656YZ92 | 26-157 | None |
| A0A3G9JDF6 | 20-149 | None |
| A0A4R6LZI9 | 20-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.