DPCstruct | MC6565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 247 ± 39 aa |
| Standard deviation of domain lengths | 39.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 17.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0C4F1 | 1-210 | MDALDHASLLLAWQETAFATGPADRPRAEAGITAAYAAAGLPAPGRFVWVSSPAEGARAAAALTDAGGSVRDAVRTRPWERARAAAA… |
| A0A2T1GGC7 | 8-242 | INDKEVNLAESYIKKWEKILFSTHLIDKDRAKAAVESAYTILNLPIPELIFLPSPYVNTGMLGTLDLSKYIFLRSCLKDKLRKSIWD… |
| A0A3B9EVX5 | 19-256 | None |
| A0A1G0QR24 | 3-336 | None |
| A0A563VY00 | 35-240 | None |
| A0A343VRI1 | 363-681 | None |
| A0A1U7I6M0 | 11-246 | None |
| A0A2D6F2T3 | 45-325 | None |
| A0A7D4XEQ5 | 12-276 | None |
| A0A0U0ZSS7 | 288-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.