DPCstruct | MC6563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 165 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U5FN31 | 10-178 | TSREEQRLQEDRDRVKYWKRWGPYVAERQWATVREDYSENGDAWSYFPHDQARSRAYRWGEDGIAGVCDTHNLQNIAFAFWNGKDGF… |
| A0A3N1ZVR0 | 3-162 | EAVAKTAEGKRLAQSASQDSAWRRWGPYVSSRQWGTVREDYSADGAAWADFPFDQAHTRAYRWGEDGLAGICDRYGFLNLAVALWNG… |
| A0A1I4CF86 | 3-133 | None |
| A0A6M0AV51 | 1-171 | None |
| A0A1C7LTB2 | 65-265 | None |
| A0A6C1DYW0 | 7-167 | None |
| A0A1F7RS87 | 3-161 | None |
| A0A2L2TID1 | 13-173 | None |
| A0A7I8CCJ2 | 11-177 | None |
| A0A376ECZ2 | 3-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.