DPCstruct | MC6561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 126 ± 22 aa |
| Standard deviation of domain lengths | 21.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.21 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0173- PF10083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9XKJ9 | 1-131 | MGYFDIAQICLNGHLINSRMKEAQQHNKNYCDICGKATINKCQKCDKEIHGYHHGGGNEFSYSLDKVPSCCYNCGKPYPWTEAKIKA… |
| A0A7X4B3H2 | 1-126 | MLKNRHGTEQQDTMQVCLNGHVINADYHKYSELNRHNCDRCGEKTITQCLNPECNKPIPGNLRKATGMIIESQQTAPDFCPYCSKAF… |
| A0A2L0KNE1 | 1-123 | None |
| Q3RI46 | 1-79 | None |
| A0A1N7DNY2 | 1-95 | None |
| A0A101W423 | 29-176 | None |
| A0A5C6E4T6 | 6-120 | None |
| A0A415VS67 | 53-203 | None |
| A0A3E0P225 | 2-98 | None |
| A0A2V6Y531 | 2-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.