DPCstruct | MC6560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7W7X4 | 3-137 | AELIINLWALYDASTGTVYALAGRAYNIAGTDRAKLDFLKMAARTDFVTTKRYRVPDRFAIVFPDGEEQRGVTYLNAVFDPNAQLFE… |
| A0A7X3ZIW0 | 4-105 | REVIVNLWYLIDEEGLIYSLRVKTYIGTGSIKEKLEFLQQRASLDYLIAEPFEIPQRFHVRIGTGPKSEIMPIAHVTSLEVSSSPIA… |
| A0A6N9C888 | 2-125 | None |
| A0A522F8Z8 | 1-117 | None |
| B1F977 | 4-105 | None |
| A0A524Q6I9 | 37-142 | None |
| I7A0F1 | 1-109 | None |
| M5UEJ4 | 185-309 | None |
| A0A4R7PED3 | 1-95 | None |
| A0A351BZZ8 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.