DPCstruct | MC656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 159 ± 5 aa |
| Standard deviation of domain lengths | 4.61 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 90.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V0NXF9 | 280-440 | LSEGHVQGCGHVRLMMEKYAEYGLKSDEMPRQLIKAFYNFFWHTPIGSAERQKINYSVMQGALAGEAIAVVESKGECAGWSPAMPPS… |
| A0A7S0Q4H2 | 2-157 | IRLASPEFVGCVHTKLQLQHPDSYTVRRPLIEQLLRSFFGILWNDYHPHQRRLALHVLDGPHAEKAVIKVTSSHWCNIEQHLVSRLP… |
| A0A0M0JZM6 | 248-408 | None |
| A0A2P6MUD2 | 199-354 | None |
| A0A1I2AEP7 | 306-464 | None |
| G0QPR9 | 177-338 | None |
| A0A4Y6PQL4 | 138-291 | None |
| A0A383VDG9 | 2-169 | None |
| A4BFQ7 | 110-258 | None |
| J9IWE9 | 755-915 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.