DPCstruct | MC6559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 126 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3XLP1 | 23-151 | IQLPLQAGTHQLLFDEDAIQDPGSLIVKLQDTRAPVSKFIASQLSEDMQWVLLGYNGAGTPSPQQQEVLLSDLNQLLQAGSLYDAQR… |
| C3WAT4 | 109-241 | KKLPRKFYLADENLKNPKGLVDRMVRESFVKMENPSNHIKNVVATQEEWEQIVAFSQQNDLSEKDTKKLRKILNKFIKRNEFYDERA… |
| A0A7C4UDZ7 | 99-237 | None |
| A0A7V4XE17 | 472-593 | None |
| A0A2N9LCQ9 | 62-181 | None |
| A0A7X7YXI6 | 38-168 | None |
| A0A2D6QW97 | 208-355 | None |
| A0A2E7RUY8 | 46-166 | None |
| A0A4P5ZF06 | 118-236 | None |
| A0A7C2PQ27 | 45-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.