DPCstruct | MC6558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 214 ± 24 aa |
| Standard deviation of domain lengths | 24.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521FKE2 | 21-238 | LERKTAEVSGAEVIGKINRLEYSHQLFARNHKHLVDILEGVVEKPEIRDRIFSRKFRWKSDLLFREISFRLHNFVASAKSLVDHSRR… |
| A0A359BK27 | 13-203 | GWQTVNRLGLLNENYHTLILNYNELKNEIIKIQTCAKPILLLFNNLNLNRYIFNFLASTTALIDSCRNTMKFYKETDLYKTYEDDVK… |
| L0IB44 | 3-233 | None |
| A0A4Z0MZI8 | 17-212 | None |
| A0A0F9K756 | 127-324 | None |
| A0A3E0VAC8 | 8-229 | None |
| A0A2S2F6V4 | 16-232 | None |
| A0A3C1RPI3 | 4-199 | None |
| I7KJ86 | 9-197 | None |
| A0A7Y6YZG7 | 58-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.