DPCstruct | MC6557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9163 |
|---|---|
| Mean domain length (aa) | 194 ± 45 aa |
| Standard deviation of domain lengths | 45.30 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.48 |
| Pfam Score | 95.90 |
| Assigned Pfam label(s) | CL0022- PF01412- CL0113- PF08518- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4VAP0 | 71-264 | WIALMHASYRGYIDCVRALIKAGANINVKDKDGSTPLMIASCWGYIDCVRALIKAGADVNLKNNYGWTALMYANRHGRIDCVQKLIK… |
| A0A521BYT4 | 11-193 | KEGQLDNVKNLLKEGADIDETAKNGSSALIIATQYDHPELVGYLLEKGADPNKATTMGATALNRAAENGNIAVMKLLFDHGAKVGDL… |
| A0A654I348 | 58-284 | None |
| A0A511TEI9 | 38-255 | None |
| A0A2J8AC17 | 221-383 | None |
| A0A2J8AFX3 | 258-484 | None |
| A0A2J8AGF1 | 252-482 | None |
| A0A2J8AI22 | 428-672 | None |
| F4PK67 | 114-341 | None |
| K2SIH9 | 804-999 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.