DPCstruct | MC6556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 204 ± 30 aa |
| Standard deviation of domain lengths | 30.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0DKK5 | 105-279 | SETSSSFVKSAFRRHRSSGFRLTDFSDLPRGVILSSTPTPVVEKDVILATQHDTFKFGDLVTHMMRILLFVPWCAAVGGALLLFPNH… |
| A0A0W0GAV1 | 1-206 | MPTVTLSQSQTESLQDSEEVAEILNQKNKDQPLLPTPSSEQVQSIKLQDILLFMIKFLCFLPWCVAAGCALVVFPKHIEAVVFFPGF… |
| A0A4Q9P019 | 87-332 | None |
| A0A369JC59 | 207-461 | None |
| A0A0D7AYN1 | 171-391 | None |
| A0A4Y9Y5C1 | 15-215 | None |
| S8DS35 | 1-149 | None |
| A0A067N6J4 | 46-260 | None |
| B0DP08 | 38-239 | None |
| A0A1M2V4L3 | 177-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.