DPCstruct | MC6555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 13.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01185 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9W458 | 3-82 | CKTGDAQCCKSTSLATNPVTALLLGLLGIVVDGAGILVGITCTPINLLAIGGATCSQQPVCCTNNSFNGVVNIGCTPISL |
| A0A0W0G838 | 5-103 | SVAFALTTFSVLAAASKCSTGPVQCCNSVQAANSPTAAGLLGILGIAVQSVTGQVGVTCSPISVLGLGSNSCNAQTVCCENNSFNGV… |
| A0A137QYM4 | 58-168 | None |
| A0A137QWX9 | 138-241 | None |
| A0A146H2F3 | 262-367 | None |
| A0A4S8MUU4 | 76-165 | None |
| A0A2H3CLX8 | 209-318 | None |
| A0A4Q9ND17 | 5-144 | None |
| A0A0C2XPT9 | 25-132 | None |
| A0A369JJV0 | 8-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.