DPCstruct | MC6554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 283 ± 68 aa |
| Standard deviation of domain lengths | 67.58 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 72.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 17.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0G0L7 | 126-401 | DSTAIFNYLIQTLTAHDFLHGINWSNKMISEPIANEDIASILSSLPGTIYNRTYLKIIARWPGDRKKWYFKLEGQWNIPDAMWESKV… |
| A0A0W0G6J9 | 84-359 | NIIRGIAGCYRPYMEKVAEKKAISILKTHPGAIYHEHSQQIIARLPATARDRLHYYLKRADVGSNAMRKSLVVMTDGSVQFTVTPMD… |
| E2LW38 | 11-198 | None |
| E2LSS0 | 4-204 | None |
| E2LJL4 | 1-193 | None |
| A0A0C9V5T2 | 5-506 | None |
| A0A0C9V5S3 | 381-738 | None |
| A0A0C9V453 | 2-211 | None |
| V2WUR0 | 231-580 | None |
| V2X8U0 | 27-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.