DPCstruct | MC6553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 166 ± 19 aa |
| Standard deviation of domain lengths | 18.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8LAW3 | 8-151 | RVNDPVCSFLIDDCVNQVASRNVPLYSVNSCALSAACDGTFNLLQLATCAQPSFEGKVASQLPSLDYDIYAGIVGECAWAPGGCSMT… |
| A0A0W0G6H1 | 1-187 | MKLTTALVALSFLLGAQAKPVKRDTPTPEQCDEWRANIGVYHDHFSPACKVLADACFAKIETGFSQPWSLHECVAAATCQGTTKTVG… |
| V2X3Z8 | 36-218 | None |
| V2X5L4 | 31-188 | None |
| E2LKJ9 | 53-207 | None |
| A0A0D7AVG3 | 1-144 | None |
| A0A409WE92 | 13-185 | None |
| A0A0D7BDR0 | 1-195 | None |
| A0A409XP18 | 11-163 | None |
| A0A0D7AWU6 | 11-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.