DPCstruct | MC6552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 138 ± 26 aa |
| Standard deviation of domain lengths | 26.14 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0G449 | 216-392 | FFEGGKVDFRNEPSHHTPYLYTLAGAPEKSAHWIREMARKNYNNTPNGLSGNEDCGQMSAWYIWSAMGFYPVNPVSGEYVVGSPFFS… |
| A0A5M5DX79 | 612-756 | GNEPCHHVAYLYNYLKEPWKCQKWVRTIVDRFYGDTPDALSGNDDCGQMSAWYMFNCIGFYPVAPSSNMYNIGSPCVEAITVRMSNG… |
| A0A127Z6N7 | 362-513 | None |
| A0A7R9YC12 | 20-161 | None |
| A0A538Q9E4 | 287-441 | None |
| A0A1M5EPK2 | 604-748 | None |
| A0A1I3K072 | 1060-1217 | None |
| A0A1V6DMN1 | 9-133 | None |
| A9WTL6 | 195-338 | None |
| A0A7C1BJB9 | 114-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.