DPCstruct | MC6550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Standard deviation of domain lengths | 17.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 46.83 |
| Pfam Score | 97.30 |
| Assigned Pfam label(s) | CL0101- CL0029- CL0267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7P8B5 | 1-91 | MISLIIPPKDQIARVNKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVIYCGTIITEEGKEKKVNIDFEPFRPI… |
| A0A0W0FS17 | 7-124 | VVEQNIQTWKIKSLDSVRGGYLHCCSYSCTQGVFRIDPLKEQIYRGSAFNIKSRINRLSVLAAITTTQQRLELYNRVPPNGLALFIG… |
| V5IFF0 | 6-138 | None |
| A0A6V7PBY3 | 70-196 | None |
| A0A834T0A8 | 161-283 | None |
| A0A6G0XNK0 | 2-106 | None |
| H0AE30 | 2-88 | None |
| A0A6A4D3J1 | 541-664 | None |
| A0A835PG26 | 148-271 | None |
| A0A1J1IPL8 | 9-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.