DPCstruct | MC6549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 300 ± 40 aa |
| Standard deviation of domain lengths | 40.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 30.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3LX40 | 114-415 | LGMLAQNGKYWYPAQLIEYLKNGYLVIQWWRECTFSHTDPSLGQPGQVTTLAEASVVDHLWHDQKWHRQICLGLWTHPAELPTAEDI… |
| A0A0W0FNU7 | 406-743 | VDEGNKTWKVKWWHLNHPAEDASHIPGSFATVDVTRIVDSLYQDVKGRRSVRLGRWKTTAELACDDYDESEKQEDPRLSLPYTKEME… |
| A0A4S8LU63 | 191-523 | None |
| B0DFT5 | 269-588 | None |
| B0CPL9 | 730-994 | None |
| A0A1C7M424 | 1-260 | None |
| A0A4S8LY73 | 80-428 | None |
| A0A284S1D3 | 23-338 | None |
| A0A0D0AEZ1 | 673-952 | None |
| V2XBF4 | 26-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.