DPCstruct | MC6548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 9.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2N013 | 172-240 | CEIDLTPLSTAVEAASFEVIKLMFEYGGHIGHGQLLHYAVRRKGGDQMEIVRFILLQGAHVDHVMYQND |
| A0A1E1LPM4 | 1-86 | MCSWGFTPMSEAMCQASLDTIKLLFERGGNIDCGQLLHNAVQRVAPDAIELIGMLLDKGAPINDIQYKNHAPSEGQYFNRQNIMVN |
| A0A2I0RJG4 | 604-683 | None |
| A0A4U0VHT3 | 173-241 | None |
| A0A6A6YFD6 | 1-96 | None |
| A0A165GKL4 | 55-123 | None |
| A0A0L0NBM6 | 115-186 | None |
| A0A1E1K8F3 | 343-422 | None |
| A0A4U0Y431 | 804-872 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.