DPCstruct | MC6547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 199 ± 24 aa |
| Standard deviation of domain lengths | 23.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 20.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05397 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X6NC29 | 1-163 | MQRVQVVGRMKPMIDEHKVKPFVGLDPGRRPTEAELQQARLYKELLLKQLIRPGIDNMIPQHVPLEYQAKYARDFDELLGYTHQVVP… |
| A0A286UAF3 | 225-392 | QLPMSNVPQPGTSTQSNIPGSAASAAMNAANAFVKSLAHLTPEQQATLNKLPIPTQDLLREATAYLVGLKEQIYISNNLVPVQMPND… |
| A0A0H2RLB2 | 631-843 | None |
| A0A5B1R1D9 | 1-195 | None |
| A0A165GEG0 | 17-239 | None |
| A0A165VNS9 | 164-363 | None |
| A0A401H2A5 | 220-426 | None |
| A0A401H2A6 | 700-879 | None |
| M2PMA7 | 163-320 | None |
| A0A6A4HY03 | 388-571 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.