DPCstruct | MC6546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C3G1E2 | 5-95 | TTVLSKYNSSPYAMLTDAFPNCLKEWELRMAPINFWTRQKALEALQWTIEEKEQLTDKQLLSVYGEKWLKKHKLLTPCSMYWNDSPY… |
| R8M8D9 | 103-205 | KWLEKNKLSAPLAMYWNSSPFAMINDLYPSRFKEWEFLMTPNNFWTKEKALEALKWTIEEKEKLTPEQILDVYSIKWLKTHRLASPC… |
| A0A6M6E2D2 | 43-173 | None |
| A0A7T3MXG6 | 1-137 | None |
| A0A7T3MXB8 | 116-249 | None |
| A0A0S8GFE3 | 124-258 | None |
| A0A559JGK5 | 193-306 | None |
| A0A2B1K4U4 | 48-160 | None |
| A0A1M5RDJ4 | 61-179 | None |
| A0A1D3MWX6 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.