DPCstruct | MC6545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 188 ± 31 aa |
| Standard deviation of domain lengths | 31.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2LSC4 | 4-151 | DVAGLLDRLAAKLGADKVNWPQWRETHKPERVEQRVDALHGTPTAAPALLRDRPLRLLTPAEEVRVIYAVPEGPPSQFNWRRVTYKT… |
| A0A0R2TXM1 | 16-189 | LTLSRLRLERLELPQSIDQISLFCDQFIDKPELSFDLFDDQITLDNQSSELIDNLYARLGVEALSQPSMSEEHLPENAGSIGPPNRS… |
| A0A1Q9RYP7 | 363-514 | None |
| A0A2V9ZNK9 | 109-329 | None |
| A0A2E3RF49 | 219-426 | None |
| A0A4S8QBZ7 | 291-457 | None |
| A0A158FIF7 | 701-845 | None |
| A0A5C7NSU4 | 420-629 | None |
| A0A6J7I3G8 | 152-340 | None |
| A0A1E3GWP6 | 206-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.