DPCstruct | MC6544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R0BJF0 | 1-100 | MKIDDKVIKRIEQAFGIQLYNWQKDYLLGKRDIIEYGRNNGKTFAYCIKLLLSDGEPIKRRELRKYADGYGNRYQECFAGYALEIND… |
| A0A1M6L0G7 | 2-118 | EQMNKELISKIEKALNIKFYEWQRKYLLNEAMLLDMRMTGRCTGKTLAHIIKQLFESSEPLLLRNKDEILDKADWWCCEIRKDRALR… |
| A0A242DHI0 | 37-151 | None |
| A0A7C7D566 | 71-176 | None |
| A0A806M1Y6 | 1-115 | None |
| A0A356CXT9 | 8-132 | None |
| A0A2C8EGY1 | 4-115 | None |
| A0A6P1MIS3 | 1-111 | None |
| C6LIR6 | 506-613 | None |
| A0A416JPR6 | 22-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.