DPCstruct | MC6542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 336 ± 37 aa |
| Standard deviation of domain lengths | 36.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0UTA8 | 523-856 | LNALHSRILDLANTALKPEGGKLPAEQRVLYVLEQLQALAKNLIDGQDLETAGTQRPTTSQGSSATSALLGSVNTRPYPSFISQASL… |
| A0A5Q0HJ78 | 12-359 | NYETLARRLAIFHKRRATPSLLADYIRANRQLQRTTNQTRHLSPGQNDLGLKVNVASSTLEKELWAVMRRYWPMCVASDLVVQTYVL… |
| A0A1E3QRT7 | 45-457 | None |
| A0A1E3NXM8 | 5-315 | None |
| A0A5N6L225 | 48-464 | None |
| A0A2V1AKF2 | 261-592 | None |
| J3P9P5 | 109-383 | None |
| A0A1E4SQI7 | 28-369 | None |
| A0A421JFH8 | 255-571 | None |
| A0A2T0FH92 | 4-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.