DPCstruct | MC6541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 9 aa |
| Standard deviation of domain lengths | 8.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0XEP5 | 37-97 | ACSVCGSSDGCLNIGRNHFYICHRHKKRWEIGSNLFSSWHNENEKIWKKNWKKIYKYDEIT |
| A0A7W5XMP7 | 11-84 | FTDDYGGLCPICHRNDGMLNVGKTHWTVCHTHKVRWSIGSNLFSGWRNETEEDWERNSKLLSAYEDVAPFLYPR |
| A0A2M8EGZ1 | 1-79 | None |
| A0A660V052 | 16-75 | None |
| A0A353P4E4 | 16-83 | None |
| A0A2D6R0Y1 | 29-93 | None |
| A0A7Z9BNG7 | 9-86 | None |
| A0A1H3HWC0 | 343-430 | None |
| A0A0G1ZSN8 | 21-80 | None |
| A0A4R1RV86 | 10-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.