DPCstruct | MC654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0DVQ4 | 2-94 | IPPPLQLAPQNEMLSPSETMNHTVSLEKFCSVYKISALDQEKLTCLGYMPGNRVVESLSNADWQHVSFSVVSWRTFLIHHHKLCKAI… |
| A0A0D0A8Z3 | 272-365 | QGQPPAAVDPPSTSSSPSVTTTHNVSLAEFCVKYRLSDGDQAKLAALEYQPGNRGVEKLDEREWRDIGKFTKLGWQSFMDAHKKFCK… |
| A0A6A4GC63 | 89-203 | None |
| A0A0C2YFI8 | 131-237 | None |
| A0A4Q2D8V8 | 141-242 | None |
| V2Y761 | 62-188 | None |
| A0A2H3DRS1 | 22-126 | None |
| A0A0C3FYL0 | 278-395 | None |
| A0A0C9SU61 | 4-100 | None |
| A0A0D2NDF7 | 2-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.