DPCstruct | MC6538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 197 ± 10 aa |
| Standard deviation of domain lengths | 9.60 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842K876 | 166-369 | AEKNLRSSIPHKLEQVMANAGQAPIMLVGKNPPPKEKVPETLGEMFVEKDMLEEEYVDIAQELYDFGDKGEKNAKEVTGEEVEEHLN… |
| A0A7C2DNZ8 | 1-209 | MESVKLYAVAEDLYYAMLNSSQALLMFLGKNAPIPKEIVRAVREYLVDEGLLPERYLKWLEEVVKFRKDVEHKRVKRITGKQLDEYI… |
| A0A2H9PRL3 | 2-196 | None |
| A0A2H9NG41 | 1-181 | None |
| A0A7T5UKP2 | 192-397 | None |
| A0A842NGW2 | 142-344 | None |
| A0A7C3ZPU0 | 337-532 | None |
| A0A7C0Y7K0 | 60-265 | None |
| A0A7J2NRW8 | 252-444 | None |
| A0A832JLV4 | 63-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.