DPCstruct | MC6537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4I6K3 | 6-90 | NIEECVYFARKQLFNDSNEAKGSIMAWVLKGEEDRIYLKYTCPFCNYRGELSLPNIWKRKRMEGKYREVVEFTCEACGRECMLVK |
| A0A7C2DDJ2 | 1-95 | MEQIEQLIKRRGIRPSDCSYHTFRTIETKDGKKGKVRVLVIKGETNAHVEYLCPQCKHQSYLVLPWKRPFSFRCEKCGFRVNVPRLR… |
| A0A256Y5H1 | 4-89 | None |
| A0A2D6WU73 | 7-102 | None |
| A0A846NI52 | 3-90 | None |
| A0A2H6K1Q8 | 1-88 | None |
| A0A842V0T1 | 5-90 | None |
| A0A256YS09 | 2-81 | None |
| A0A497J6U0 | 15-92 | None |
| A0A7C3M573 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.