DPCstruct | MC6536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846Q4R8 | 15-95 | CKGIETPPACEEYWMCSAWSECNELNLKTRECNDVNLCGTGRLKPEETAECREEPFPSLTFFGIIVFVLTTIYLLVDRYKK |
| A0A7C0UVG5 | 3-112 | AEEEVSGTPEEEEECREKWVCTDWGPCINGRQTRTCWDENNCGTDLYKPFEVQPCVSEEVTQESGFDFSATGRFLTSPVGVGVIGLV… |
| A0A3D5RZ59 | 222-320 | None |
| A0A7J4M679 | 32-150 | None |
| A0A7V4KHZ7 | 547-635 | None |
| A0A846NGN2 | 75-195 | None |
| A0A3M1FAD3 | 136-252 | None |
| A0A2G9MCS9 | 18-105 | None |
| A0A7J4UPF1 | 63-173 | None |
| A0A662QMP7 | 28-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.