DPCstruct | MC6535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 161 ± 13 aa |
| Standard deviation of domain lengths | 13.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838RQZ4 | 3-157 | LDDTLRELKNKIPGFSLESRREADKELRTATAAAFTSQVSRLTRVQEQALKEGDFDILETLDRIITRLQHLGDRIRTASYGYTGLFD… |
| A0A497TEA5 | 8-187 | EDAKLRLWSKVKKLKKHIPDYGYSDSNRAYSTDEKFCRFVIQKLRDVKWKIVDVLNMLFETGVNNLEMLEKTKNEIDMFLDEVKIRE… |
| A0A7V3GTK8 | 9-178 | None |
| A0A0Q4B537 | 12-167 | None |
| A0A497SN58 | 5-189 | None |
| A0A6J4VD58 | 13-177 | None |
| A0A1E7I6M9 | 35-198 | None |
| A0A2E7AYK8 | 6-152 | None |
| A0A7X7XE03 | 4-170 | None |
| A0A662TC09 | 3-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.