DPCstruct | MC6533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 131 ± 16 aa |
| Standard deviation of domain lengths | 15.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B9T7U0 | 1-125 | MTVMARDRDYETLLEDVRGRKVLVWTCNTCARLCNIGGQDAGQRLADRLSRDGVEVAGCVSSSAPCFMSKADRMAASVEGDYDLVVS… |
| A0A497TBK9 | 1-117 | MIITETKPFGMIKTELEKTDKISIIACNMCARMCETGGKTGLKQMKEKVKNAGYSVVDEFLLAPVCDRSVVKKRVKPKGNIIISLAC… |
| A0A846NT62 | 2-123 | None |
| A0A202DBZ7 | 96-216 | None |
| A0A7J3BES7 | 86-220 | None |
| A0A7V4NJN4 | 1-179 | None |
| A0A2N2PQX8 | 1-138 | None |
| A0A7Y4DET4 | 1-138 | None |
| A6UTR8 | 3-142 | None |
| A0A3M0SMI7 | 3-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.