DPCstruct | MC6532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 285 ± 37 aa |
| Standard deviation of domain lengths | 37.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0MML7 | 5-267 | RKEPISTSLPDARWGDPTQDNFTPPSTRRELTQLQRTANGGFLLQAGYYRFHDQSYCLHAGTHGPGGGDGYLYAPPLGSAKDAVISI… |
| A0A2T1E3C3 | 56-359 | FFGLPIPNLPIPGGSVEDLLKGAVVDQAVKALGSTLKDDAPIESSSQATFPTVNQLPGTAFKPKAMPTTLMAQLRNATDGAVALQPG… |
| A0A348V2U3 | 18-284 | None |
| G1UP61 | 139-388 | None |
| A0A2D8LK70 | 1-322 | None |
| A0A7Y4VII8 | 2-315 | None |
| A0A7Y9G3W8 | 118-352 | None |
| A0A844MQ87 | 72-378 | None |
| A0A7G8PXZ7 | 6-311 | None |
| A0A350XIU2 | 66-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.