DPCstruct | MC6530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 6.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F2NSP2 | 15-87 | FTVSQLIEVLQTLPQELPVLVSGYETGYENFHQPTVITLKHEPENMYFEGEFQTTETGDTEIFAAVVLERVQR |
| A0A2T1DU40 | 1-88 | MNVRELIEALSQFDPETRVVVAGYEEGFNDITQVQAEQIRLNAYRDWFYGSHAKADDERVRQSLPDAPEVMAIALTGKNQTTEGLDSS |
| A0A1H5RLZ5 | 5-82 | None |
| A0A2D5EB04 | 1-89 | None |
| A0A1I5KNB4 | 1-89 | None |
| A0A6M3JPW7 | 1-71 | None |
| A0A1I0HNB6 | 1-79 | None |
| A0A1X1T2Q5 | 10-97 | None |
| A0A3N6MR58 | 121-209 | None |
| A0A3C0Y8R0 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.