DPCstruct | MC653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 127 ± 22 aa |
| Standard deviation of domain lengths | 21.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0DUS4 | 9-102 | AAPPVLVLRNRQKSERAKLACQNCRRDNKKCDDQRPCSRCVARREDCVHVGRGPKLVKLRCESCRQENRKCEDARPCKQCVEQGKEC… |
| A0A6U5ZI59 | 66-167 | PGDSDDPKPSSQRRARLACRVCKQRKMKCDDLNPCSRCLESSADCVRDGVLPPEQPAEKKRGRNQTKQACTYCRERKMKCEAQRPCW… |
| A0A5C2SQ50 | 2-128 | None |
| A0A4S9N657 | 307-422 | None |
| A0A146HUL5 | 6-123 | None |
| A0A146IHI7 | 141-281 | None |
| A0A093Y884 | 20-162 | None |
| A0A3D8RBZ5 | 2-184 | None |
| A0A5C3PN94 | 2-104 | None |
| L1JWG1 | 3-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.