DPCstruct | MC6529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 164 ± 21 aa |
| Standard deviation of domain lengths | 21.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q3SH22 | 113-282 | NHNNGGDMDMTLQLSRTVKGQEEIFNLGHTLRPRQRQILFTVGNGISFGELRSKLPNCAELETMVNDLLQSGFIQALRTMAGGSAAA… |
| A0A7V1G8E9 | 2-136 | KTEKGEEEIKSRKYSVPLSLRHVLILIDGKSNAVKILEKGRGLPDIMNSLDELVTRGLIEALPSSEVDTMKADLIKAAKDILGAHAE… |
| A0A5C7G292 | 13-139 | None |
| A0A0Q7AU15 | 1-212 | None |
| A0A6G0ZX42 | 3-195 | None |
| A0A7Z1YCP1 | 2-194 | None |
| A0A849KCH6 | 1-142 | None |
| A0A238D3L2 | 1-170 | None |
| A0A3S0U1P3 | 1-168 | None |
| A0A4Q7LWC6 | 26-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.