DPCstruct | MC6526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 174 ± 17 aa |
| Standard deviation of domain lengths | 17.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 61.42 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0123- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1X0S3 | 2-166 | LLSCSKDGFIQDLVLFYERVLHECLVIEKLPILNGSPLDLFNLYVEVCKRGGFECKTGINWKGQVFRKMSNYTEDNKQTGVGNALKK… |
| A0A2K3D9S9 | 16-181 | LSACSEAQFYDDLCEFLTLLRGKTVERSKFPEAVLNGVSLDLFALYREVVSRGGFRVGNGINWKGQVFPRMRNWTESNKQTGVGNAL… |
| A9S710 | 446-610 | None |
| I1CA66 | 108-272 | None |
| A0A6P6FY93 | 310-473 | None |
| A9TE17 | 513-680 | None |
| A0A5D3D6I3 | 538-761 | None |
| A0A7J8S8G2 | 174-334 | None |
| A0A287RHS9 | 347-511 | None |
| A0A453KVG3 | 217-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.