DPCstruct | MC6523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 144 ± 8 aa |
| Standard deviation of domain lengths | 8.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 63.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8A8L4 | 466-599 | SPALEPGPWCFNMPLWGNPFLPGATAGQSLEADFADLAGIRGFNTVGMAVRCCAAMTALLLTAPITPPGQPVNPAVARQLTQAYHAT… |
| A0A2K3CTM2 | 1-156 | MGVIRGSLLGYLPPVTILRPAVLVPGPWCFALPLWGNPVLPCAAGLQAGGLERDFPALMALPGLLTLGTAVRCWEALAAVRQLVASK… |
| A0A2J7ZNX8 | 138-282 | None |
| A0A2J7ZUZ9 | 143-278 | None |
| A0A2J8AD92 | 251-384 | None |
| A8JJH4 | 36-189 | None |
| A0A2K3DEC5 | 12-166 | None |
| A8I0J6 | 1-137 | None |
| A0A2K3D9B5 | 222-367 | None |
| A0A2K3CQP5 | 1000-1145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.