DPCstruct | MC6522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 12.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0005 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4L0E9 | 5-118 | LLCLFCLAFAAASASVLPVKRSHLPAVNQHGETVWLDELNQGVPDKCDFACTDQDVEVCAHNGQCLQLFTSRCTMAAYNCRNPQKRF… |
| B4N3F7 | 3-119 | QLLLLSVVCICVYASVQAKVMPMMKAHDLVINANGELVWADELTSVPDACDFHCTDQDLPVCAHNGQCLQMFTSSCTMSSYNCRHPQ… |
| A0A1I8MT80 | 385-480 | None |
| A0A6J2UHQ4 | 229-363 | None |
| A0A1B0AW29 | 1-96 | None |
| A0A1A9WE55 | 41-147 | None |
| A0A0L0CKC1 | 99-192 | None |
| A0A0L0C1E8 | 1-78 | None |
| A0A1I8PJF5 | 819-924 | None |
| A0A6I8UDB5 | 246-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.