DPCstruct | MC6521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 255 ± 39 aa |
| Standard deviation of domain lengths | 39.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 65.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.49 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF10512- PF10444 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3LGU9 | 1-275 | MYANMPVLRTNKKKAGTAPLALKKKKSALDELNIENFLEDLSVEIQSKCETIKWKADAMCDMIKNAYANEIFKLPKNIRAMNVGEFE… |
| B4MSA0 | 2-248 | EDTFNAADDLEEQFKASVDTQVNSLKLMISKDLKEMKMGEFKKVIGDLSRFSDFKMSELTKMKAPPPKASCDRRLRKTGRQNDSGLG… |
| A0A210PT53 | 1-276 | None |
| A0A0N1I5A4 | 4-191 | None |
| A0A6S7FSG8 | 45-312 | None |
| A0A1A9XM66 | 31-287 | None |
| A0A4C1Y508 | 6-265 | None |
| A0A7J7ACI8 | 45-255 | None |
| D6WPZ6 | 8-237 | None |
| A0A553N8X0 | 1-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.